PDB entry 1m27

View 1m27 on RCSB PDB site
Description: Crystal structure of SAP/FynSH3/SLAM ternary complex
Deposited on 2002-06-21, released 2003-05-06
The last revision prior to the SCOP 1.67 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m27a_
  • Chain 'C':
    Domains in SCOP 1.67: d1m27c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m27A (A:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m27C (C:)
    vtlfvalydyearteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvds
    i