PDB entry 1m12

View 1m12 on RCSB PDB site
Description: NMR solution structure of human Saposin C
Class: membrane protein
Keywords: disulfide bridges, alpha-helices, MEMBRANE PROTEIN
Deposited on 2002-06-17, released 2003-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saposin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07602 (0-79)
      • cloning artifact (80-83)
    Domains in SCOPe 2.06: d1m12a1, d1m12a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m12A (A:)
    sdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssils
    illeevspelvcsmlhlcsglvpr