PDB entry 1m0w

View 1m0w on RCSB PDB site
Description: Yeast Glutathione Synthase Bound to gamma-glutamyl-cysteine, AMP-PNP and 2 Magnesium Ions
Class: ligase
Keywords: Amine/Carboxylate Ligase, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2002-06-14, released 2002-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione synthetase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m0wa1, d1m0wa2
  • Chain 'B':
    Compound: glutathione synthetase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m0wb1, d1m0wb2
  • Heterogens: MG, SO4, ANP, 3GC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m0wA (A:)
    mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfde
    avqiqpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkq
    nfrlgifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpi
    yndqnmvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvleln
    llekfgtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwe
    arlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiypld
    dtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliep
    elnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaa
    gfgcldsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0wA (A:)
    pskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiq
    pvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlg
    ifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqn
    mvisdsgyllskalakavesyksqqsdpivafivqrnernvfdqkvlelnllekfgtksv
    rltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfa
    ikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkr
    lalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliepelnenniilr
    dnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgcldsiil
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m0wB (B:)
    mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfde
    avqiqpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkq
    nfrlgifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpi
    yndqnmvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvleln
    llekfgtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwe
    arlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiypld
    dtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliep
    elnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaa
    gfgcldsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0wB (B:)
    ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
    qpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrl
    gifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndq
    nmvisdsgyllskalakavesyksqqdpivafivqrnernvfdqkvlelnllekfgtksv
    rltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfa
    ikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkr
    lalsepskyvlkpqregnnvykenipnflkgieerhwdayilmeliepelnenniilrdn
    ksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgcldsiily