PDB entry 1m0w

View 1m0w on RCSB PDB site
Description: yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions
Deposited on 2002-06-14, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m0wA (A:)
    pskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiq
    pvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlg
    ifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqn
    mvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvlelnllekf
    gtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfl
    eksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklg
    regkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliepelnen
    niilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgcl
    dsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0wA (A:)
    pskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiq
    pvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlg
    ifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqn
    mvisdsgyllskalakavesyksqqsdpivafivqrnernvfdqkvlelnllekfgtksv
    rltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfa
    ikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkr
    lalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliepelnenniilr
    dnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgcldsiil
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m0wB (B:)
    ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
    qpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrl
    gifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndq
    nmvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvlelnllek
    fgtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlf
    leksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtkl
    gregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliepelne
    nniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgc
    ldsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0wB (B:)
    ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
    qpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrl
    gifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndq
    nmvisdsgyllskalakavesyksqqdpivafivqrnernvfdqkvlelnllekfgtksv
    rltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfa
    ikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkr
    lalsepskyvlkpqregnnvykenipnflkgieerhwdayilmeliepelnenniilrdn
    ksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfgcldsiily