PDB entry 1m0t

View 1m0t on RCSB PDB site
Description: Yeast Glutathione Synthase
Class: ligase
Keywords: AMINE/CARBOXYLATE LIGASE, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2002-06-14, released 2002-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione synthetase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m0ta1, d1m0ta2
  • Chain 'B':
    Compound: glutathione synthetase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m0tb1, d1m0tb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m0tA (A:)
    mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfde
    avqiqpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkq
    nfrlgifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpi
    yndqnmvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvleln
    llekfgtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwe
    arlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiypld
    dtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliep
    elnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaa
    gfgcldsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0tA (A:)
    ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
    qpvfnelyaritqdmaqpdsylftgklwslylatlksaqykkqnfrlgifrsdylidkke
    qikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskala
    kavesyksqqsssttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndk
    lfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfaikapdlltql
    sgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkrlalsepskyv
    lkpqgnnvykenipnflkgieerhwdayilmeliepelnenniilrdnksynepiiselg
    iygcvlfndeqvlsnefsgsllrskgcldsiily
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m0tB (B:)
    mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfde
    avqiqpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkq
    nfrlgifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpi
    yndqnmvisdsgyllskalakavesyksqqsssttsdpivafivqrnernvfdqkvleln
    llekfgtksvrltfddvndklfiddktgklfirdteqeiavvyyrtgytttdytsekdwe
    arlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaekkssllktfvkiypld
    dtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmeliep
    elnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaa
    gfgcldsiily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m0tB (B:)
    ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
    qpvfnelyaritqdmaqpdsyleftgklwslylatlksaqykkqnfrlgifrsdylidkk
    eqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskal
    akavesyksqqsssttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvnd
    klfiddktgklfirdteqeiavvyyrtgytttdytsekdwearlfleksfaikapdlltq
    lsgskkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregkrlalsepsky
    vlkpqnnvykenipnflkgieerhwdayilmeliepelnenniilrdnksynepiiselg
    iygcvlfndeqvlsnefsgsllrskfgcldsiily