PDB entry 1lzy

View 1lzy on RCSB PDB site
Description: x-ray structure of turkey egg lysozyme complex with di-n-acetylchitobiose. recognition and binding of alpha-anomeric form
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-01-09, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: turkey egg white lysozyme
  Species: Meleagris gallopavo [TaxId:9103]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00703 (0-128)
  Domains in SCOPe 2.07: d1lzya_
• Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lzyA (A:)
  kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
  rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
  hawirgcrl