PDB entry 1lzy

View 1lzy on RCSB PDB site
Description: x-ray structure of turkey egg lysozyme complex with di-n- acetylchitobiose. recognition and binding of alpha-anomeric form
Deposited on 1995-01-09, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.55 Å
R-factor: 0.175
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1lzy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lzy_ (-)
  kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
  rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
  hawirgcrl