PDB entry 1lzw

View 1lzw on RCSB PDB site
Description: structural basis of clps-mediated switch in clpa substrate recognition
Deposited on 2002-06-11, released 2002-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lzwa_
  • Chain 'B':
    Domains in SCOP 1.63: d1lzwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lzwA (A:)
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lzwB (B:)
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
ayllrkhevsrldvvnfishgtrkde