PDB entry 1lzr

View 1lzr on RCSB PDB site
Description: structural changes of the active site cleft and different saccharide binding modes in human lysozyme co-crystallized with hexa-n-acetyl- chitohexaose at ph 4.0
Deposited on 1994-09-14, released 1995-04-20
The last revision prior to the SCOP 1.69 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.14
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1lzr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lzr_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv