PDB entry 1lzj

View 1lzj on RCSB PDB site
Description: Glycosyltransferase B + UDP + H antigen acceptor
Class: transferase
Keywords: glycoprotein, transmembrane, signal-anchor, blood group antigen, transferase
Deposited on 2002-06-10, released 2002-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.184
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyltransferase B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAD26574 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.06: d1lzja_
  • Heterogens: HG, MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lzjA (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
    aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzjA (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgerrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
    fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp