PDB entry 1lz3

View 1lz3 on RCSB PDB site
Description: x-ray structure of monoclinic turkey egg lysozyme at 1.3 a resolution
Deposited on 1991-11-13, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1lz3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lz3_ (-)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfdthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggdgmnawvawrnrckgtdv
    hawirgcrl