PDB entry 1lz2

View 1lz2 on RCSB PDB site
Description: crystallographic study of turkey egg-white lysozyme and its complex with a disaccharide
Deposited on 1981-09-21, released 1981-12-08
The last revision prior to the SCOP 1.67 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1lz2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lz2_ (-)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntngstdygilqins
    rwwcdngrtpgsrnlcnipcsallssditasvncakkiasggdgmnawvawrnrckgtdv
    hawirgcrl