PDB entry 1lxl

View 1lxl on RCSB PDB site
Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure
Deposited on 1996-04-04, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lxl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxl_ (-)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
    whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh