PDB entry 1lwu

View 1lwu on RCSB PDB site
Description: Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide
Deposited on 2002-06-03, released 2002-08-23
The last revision prior to the SCOP 1.63 freeze date was dated 2002-08-23, with a file datestamp of 2002-08-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuA (A:)
    nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
    kgscaryleyrldkeknlqlekaasyianlkferfeevv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuB (B:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuC (C:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrpcqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghggqqq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuD (D:)
    nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
    kgscaryleyrldkeknlqlekaasyianlkferfeevv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuE (E:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuF (F:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrpcqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghggqqq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuG (G:)
    nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
    kgscaryleyrldkeknlqlekaasyianlkferfeevv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuH (H:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuI (I:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrpcqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuJ (J:)
    nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
    kgscaryleyrldkeknlqlekaasyianlkferfeevv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuK (K:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lwuL (L:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrpcqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghg