PDB entry 1lw5

View 1lw5 on RCSB PDB site
Description: X-ray structure of L-Threonine Aldolase (low-specificity) in complex with glycine
Class: lyase
Keywords: pyridoxal-5-phosphate, PLP, enzyme, product complex, threonine, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2002-05-30, released 2002-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lw5a_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lw5b_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lw5c_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X266 (4-346)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d1lw5d_
  • Heterogens: CA, CL, PLG, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lw5A (A:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw5A (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lw5B (B:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw5B (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lw5C (C:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw5C (C:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lw5D (D:)
    gphmmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvp
    sgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvr
    kairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnas
    iasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvl
    aaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgf
    iealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lw5D (D:)
    mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
    mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
    rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
    gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
    giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
    lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs