PDB entry 1lvm

View 1lvm on RCSB PDB site
Description: catalytically active tobacco etch virus protease complexed with product
Class: Viral protein
Keywords: Beta Barrel, Chymotrypsin-type Cystein Protease, Enzyme-peptide Complex, Viral protein
Deposited on 2002-05-28, released 2002-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalytic domain of the nuclear inclusion protein a (nia)
    Species: Tobacco etch virus [TaxId:12227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04517 (8-228)
      • expression tag (0-7)
      • engineered (226)
    Domains in SCOPe 2.06: d1lvm.1
  • Chain 'B':
    Compound: catalytic domain of the nuclear inclusion protein a (nia)
    Species: Tobacco etch virus [TaxId:12227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04517 (Start-228)
      • engineered (226)
    Domains in SCOPe 2.06: d1lvmb_
  • Chain 'C':
    Compound: oligopeptide substrate for the protease
    Species: Tobacco etch virus [TaxId:12227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: oligopeptide substrate for the protease
    Species: Tobacco etch virus [TaxId:12227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: catalytic domain of the nuclear inclusion protein a (nia)
    Species: Tobacco etch virus [TaxId:12227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lvm.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvmA (A:)
    ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn
    gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv
    ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf
    tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lvmB (B:)
    ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn
    gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv
    ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf
    tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lvmB (B:)
    slfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhg
    vfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksms
    smvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnftntnnyftsv
    pknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvmE (E:)
    eatqlmn