PDB entry 1lvh

View 1lvh on RCSB PDB site
Description: The Structure of Phosphorylated beta-phosphoglucomutase from Lactoccocus lactis to 2.3 angstrom resolution
Class: Isomerase
Keywords: HAD superfamily, phosphoaspartate, aspartylphosphate, Isomerase
Deposited on 2002-05-28, released 2002-08-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-220)
      • modified residue (7)
    Domains in SCOPe 2.01: d1lvha_
  • Chain 'B':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-220)
      • modified residue (7)
    Domains in SCOPe 2.01: d1lvhb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvhA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvhB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk