PDB entry 1lvh

View 1lvh on RCSB PDB site
Description: The Structure of Phosphorylated beta-phosphoglucomutase from Lactoccocus lactis to 2.3 angstrom resolution
Deposited on 2002-05-28, released 2002-08-14
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.244
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1lvha_
  • Chain 'B':
    Domains in SCOP 1.61: d1lvhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvhA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lvhB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk