PDB entry 1lve

View 1lve on RCSB PDB site
Description: structure of the variable domain of human immunoglobulin k-4 light chain len
Class: immunoglobulin
Keywords: immunoglobulin, bence-jones protein
Deposited on 1996-07-17, released 1998-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: len, a variable domain from kappa-4 type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lvea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikrtvaaps
    vf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr