PDB entry 1lve

View 1lve on RCSB PDB site
Description: structure of the variable domain of human immunoglobulin k-4 light chain len
Deposited on 1996-07-17, released 1998-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-21, with a file datestamp of 1998-01-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.16
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lve__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lve_ (-)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr