PDB entry 1lv1

View 1lv1 on RCSB PDB site
Description: Crystal Structure Analysis of the non-active site mutant of tethered HIV-1 protease to 2.1A resolution
Class: hydrolase
Keywords: beta-ribbon flap, Hydrolase
Deposited on 2002-05-24, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (104-202)
      • engineered (94)
      • engineered (198)
    Domains in SCOPe 2.07: d1lv1a1, d1lv1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lv1A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfggssgpqvtlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lv1A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfpqvtlwqrplvtikiggqlke
    alldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvlvgptp
    vniigrnlltqigatlnf