PDB entry 1lur

View 1lur on RCSB PDB site
Description: Crystal Structure of the GalM/aldose Epimerase Homologue from C. elegans, Northeast Structural Genomics Target WR66
Deposited on 2002-05-23, released 2003-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.224
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1lura_
  • Chain 'B':
    Domains in SCOP 1.65: d1lurb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lurA (A:)
    mshhhhhhsmasgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefe
    kdaasigktvgrvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhape
    svsfsvraneqddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgs
    dtvaehflemeadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldnd
    lvitkktppstpstylrfwseksgielsittsypvihlyaskfldckgkkgehykankal
    aiepqfhsaapnfdhfpdvslrpgdhycqeivytfshvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lurA (A:)
    asgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktv
    grvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvrane
    qddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflem
    eadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldndlvitkktpst
    ylrfwseksgielsittsypvihlyaskfldckgkkgehykankalaiepqfhsaapnfd
    hfpdvslrpgdhycqeivytfshvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lurB (B:)
    mshhhhhhsmasgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefe
    kdaasigktvgrvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhape
    svsfsvraneqddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgs
    dtvaehflemeadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldnd
    lvitkktppstpstylrfwseksgielsittsypvihlyaskfldckgkkgehykankal
    aiepqfhsaapnfdhfpdvslrpgdhycqeivytfshvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lurB (B:)
    asgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktv
    grvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvrane
    qddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflem
    eadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldndlvitkktpst
    ylrfwseksgielsittsypvihlyaskfldckgkkgehykankalaiepqfhsaapnfd
    hfpdvslrpgdhycqeivytfshvn