PDB entry 1lud

View 1lud on RCSB PDB site
Description: solution structure of dihydrofolate reductase complexed with trimethoprim and nadph, 24 structures
Class: oxidoreductase
Keywords: dhfr, inhibitor-enzyme complex, oxidoreductase
Deposited on 2002-05-22, released 2002-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Lactobacillus casei [TaxId:1582]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00381 (0-161)
  Domains in SCOPe 2.08: d1luda_
• Heterogens: NDP, TRR

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ludA (A:)
  taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
  vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
  sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka