PDB entry 1luc

View 1luc on RCSB PDB site
Description: bacterial luciferase
Class: flavoprotein
Keywords: monooxygenase, flavoprotein
Deposited on 1996-05-10, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1luca_
  • Chain 'B':
    Compound: bacterial luciferase
    Species: Vibrio harveyi [TaxId:669]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lucb_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lucA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
    vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lucA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifridysyeinpvgtpeeciaiiqqdidatgidniccgfea
    ngseeeiiasmklfqsdvmpylkekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lucB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lucB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnaniv