PDB entry 1lth

View 1lth on RCSB PDB site
Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control
Class: oxidoreductase
Keywords: oxidoreductase, choh(d)-nad(a), allosteric enzyme
Deposited on 1995-01-04, released 1995-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: l-lactate dehydrogenase (t- and r- state tetramer complex)
    Species: Bifidobacterium longum [TaxId:1679]
    Gene: BIFIDOBACTERIUM LONGUM LDH GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19869 (Start-318)
      • conflict (198)
    Domains in SCOPe 2.06: d1lthr1, d1lthr2
  • Chain 'T':
    Compound: l-lactate dehydrogenase (t- and r- state tetramer complex)
    Species: Bifidobacterium longum [TaxId:1679]
    Gene: BIFIDOBACTERIUM LONGUM LDH GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19869 (Start-318)
      • conflict (198)
    Domains in SCOPe 2.06: d1ltht1, d1ltht2
  • Heterogens: FBP, NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1lthR (R:)
    aettvkptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyp
    tvsidgsddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiy
    mlitnpvdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiageh
    gdsevplwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyai
    gmsgvdiieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkel
    aalkrsaetlketaaqfgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lthR (R:)
    ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
    sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
    vdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiagehgdsevp
    lwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyaigmsgvd
    iieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkelaalkrs
    aetlketaaqfgf
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1lthT (T:)
    aettvkptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyp
    tvsidgsddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiy
    mlitnpvdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiageh
    gdsevplwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyai
    gmsgvdiieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkel
    aalkrsaetlketaaqfgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lthT (T:)
    ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
    sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
    vdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiagehgdsevp
    lwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyaigmsgvd
    iieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkelaalkrs
    aetlketaaqfgf