PDB entry 1lsv

View 1lsv on RCSB PDB site
Description: Crystal structure of the CO-bound BjFixL heme domain
Deposited on 2002-05-19, released 2002-11-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lsva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsvA (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq