PDB entry 1lsp

View 1lsp on RCSB PDB site
Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases
Deposited on 1995-02-09, released 1996-01-01
The last revision prior to the SCOP 1.59 freeze date was dated 1996-01-01, with a file datestamp of 1996-01-04.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1lsp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsp_ (-)
    rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
    vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
    tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
    kqhgy