PDB entry 1lsn

View 1lsn on RCSB PDB site
Description: thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume and conserved buried water molecules
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-09-13, released 1994-11-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hen egg white lysozyme
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • conflict (90)
    • conflict (100)
  Domains in SCOPe 2.03: d1lsna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lsnA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
  rwwcndgrtpgsrnlcnipcsallssditaavncakkivsngngmnawvawrnrckgtdv
  qawirgcrl