PDB entry 1lsm

View 1lsm on RCSB PDB site
Description: thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume and conserved buried water molecules
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-09-13, released 1994-11-30
The last revision prior to the SCOP 1.73 freeze date was dated 1994-11-30, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hen egg white lysozyme
  Species: Gallus gallus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • conflict (54)
    • conflict (90)
    • conflict (100)
  Domains in SCOP 1.73: d1lsma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lsmA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygllqins
  rwwcndgrtpgsrnlcnipcsallssditatvncakkivssgngmnawvawrnrckgtdv
  qawirgcrl