PDB entry 1lsm

View 1lsm on RCSB PDB site
Description: thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume and conserved buried water molecules
Deposited on 1994-09-13, released 1994-11-30
The last revision prior to the SCOP 1.57 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1lsm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lsm_ (-)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygllqins
  rwwcndgrtpgsrnlcnipcsallssditatvncakkivssgngmnawvawrnrckgtdv
  qawirgcrl