PDB entry 1lsi

View 1lsi on RCSB PDB site
Description: lsiii (nmr, 23 structures)
Class: neurotoxin
Keywords: venom, multigene family, neurotoxin
Deposited on 1995-11-26, released 1996-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lsiii
    Species: Laticauda semifasciata [TaxId:8631]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lsia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsiA (A:)
    recylnphdtqtcpsgqeicyvkswcnawcssrgkvlefgcaatcpsvntgteikccsad
    kcntyp