PDB entry 1lsg

View 1lsg on RCSB PDB site
Description: three-dimensional structure of the platelet integrin recognition segment of the fibrinogen gamma chain obtained by carrier protein-driven crystallization
Class: hybrid protein
Keywords: lysozyme, fibrinogen, hybrid protein
Deposited on 1994-10-25, released 1995-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hen egg white lysozyme
    Species: Gallus gallus [TaxId:9031]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lsga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lsgA (A:)
mkvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqin
srwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtd
vqawirgcrlqqhhlggakqagdv