PDB entry 1lsg

View 1lsg on RCSB PDB site
Description: three-dimensional structure of the platelet integrin recognition segment of the fibrinogen gamma chain obtained by carrier protein-driven crystallization
Deposited on 1994-10-25, released 1995-09-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1lsg_1

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsg_ (-)
    mkvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqin
    srwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtd
    vqawirgcrlqqhhlggakqagdv