PDB entry 1ls9

View 1ls9 on RCSB PDB site
Description: Structure of the Cytochrome c6 from the Green Alga Cladophora glomerata
Class: electron transport
Keywords: omega loop, antiparallel beta-sheet, PROTOPORPHYRIN IX CONTAINING FE, heme, haem, CYTOCHROME, ELECTRON TRANSPORT
Deposited on 2002-05-17, released 2002-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.149
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Cladophora glomerata [TaxId:162068]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ls9a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ls9A (A:)
vdaelladgkkvfagncaachlggnnsvladktlkkdaiekyleggltleaikyqvnngk
gampawadrldeddieavsnyvydqavnskw