PDB entry 1ls8

View 1ls8 on RCSB PDB site
Description: nmr structure of the unliganded bombyx mori pheromone-binding protein at physiological ph
Deposited on 2002-05-17, released 2002-11-20
The last revision prior to the SCOP 1.71 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ls8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ls8A (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavgeilaev