PDB entry 1ls0

View 1ls0 on RCSB PDB site
Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation
Class: immune system
Keywords: IgE Fc, Immunoglobulin E
Deposited on 2002-05-16, released 2002-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2002-09-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin heavy chain epsilon-1
    Species: HOMO SAPIENS
    Gene: IgE(ND)
    Database cross-references and differences (RAF-indexed):
    • GB AAB59424
      • engineered (44)
      • engineered (150)
    Domains in SCOPe 2.06: d1ls0a4, d1ls0a5, d1ls0a6
  • Chain 'B':
    Compound: Immunoglobulin heavy chain epsilon-1
    Species: HOMO SAPIENS
    Gene: IgE(ND)
    Database cross-references and differences (RAF-indexed):
    • GB AAB59424
      • engineered (44)
      • engineered (150)
    Domains in SCOPe 2.06: d1ls0b4, d1ls0b5, d1ls0b6
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ls0A (A:)
    divasrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdls
    tasttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsayl
    srpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvt
    stlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkr
    tlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkd
    eficravheaaspsqtvqravsvnpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ls0A (A:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ls0B (B:)
    divasrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdls
    tasttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsayl
    srpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvt
    stlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkr
    tlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkd
    eficravheaaspsqtvqravsvnpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ls0B (B:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnpg