PDB entry 1lr4

View 1lr4 on RCSB PDB site
Description: Room Temperature Crystal Structure of the Apo-form of the catalytic subunit of protein kinase CK2 from Zea mays
Class: transferase
Keywords: protein kinase, CK2, casein kinase 2, dual-cosubstrate specificity
Deposited on 2002-05-14, released 2002-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase ck2
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lr4a_
  • Heterogens: BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lr4A (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lr4A (A:)
    skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
    ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
    tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
    eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
    kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
    ydhqerltaleamthpyfqqvraaens