PDB entry 1lqf

View 1lqf on RCSB PDB site
Description: Structure of PTP1b in Complex with a Peptidic Bisphosphonate Inhibitor
Class: hydrolase
Keywords: Phosphatase, phosphonates, diabetes, inhibitor, HYDROLASE
Deposited on 2002-05-10, released 2002-07-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-294)
      • see remark 999 (8-11)
    Domains in SCOPe 2.04: d1lqfa_
  • Chain 'B':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-294)
      • see remark 999 (8-11)
    Domains in SCOPe 2.04: d1lqfb_
  • Chain 'C':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-294)
      • see remark 999 (8-11)
    Domains in SCOPe 2.04: d1lqfc_
  • Chain 'D':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-294)
      • see remark 999 (8-11)
    Domains in SCOPe 2.04: d1lqfd_
  • Heterogens: BGD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqfA (A:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqfA (A:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqfB (B:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqfB (B:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lqfC (C:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqfC (C:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lqfD (D:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqfD (D:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg