PDB entry 1lqf

View 1lqf on RCSB PDB site
Description:
Deposited on 2002-05-10, released 2002-07-24
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1lqfa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1lqfb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1lqfc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1lqfd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqfA (A:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqfB (B:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqfC (C:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqfD (D:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg