PDB entry 1loz

View 1loz on RCSB PDB site
Description: amyloidogenic variant (i56t) variant of human lysozyme
Class: hydrolase
Keywords: hydrolase, enzyme, beta-1,4-glycan-hydrolases
Deposited on 1997-01-16, released 1997-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 1997-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene: MUTANT HUMAN LYSOZYME
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1loza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lozA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv