PDB entry 1lou

View 1lou on RCSB PDB site
Description: ribosomal protein s6
Class: ribosome
Keywords: protein folding, two-state model, transition state, reaction coordinate, protein engineering, ribosome
Deposited on 1998-11-25, released 1998-11-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered (29)
    Domains in SCOPe 2.01: d1loua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1louA (A:)
    mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1louA (A:)
    mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepf