PDB entry 1lok

View 1lok on RCSB PDB site
Description: The 1.20 Angstrom Resolution Crystal Structure of the Aminopeptidase from Aeromonas proteolytica Complexed with Tris: A Tale of Buffer Inhibition
Class: hydrolase
Keywords: metalloenzyme, aminopeptidase, tris, high resolution, metal coordination, mechanism, HYDROLASE
Deposited on 2002-05-06, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.145
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bacterial leucyl aminopeptidase
  Species: Vibrio proteolyticus [TaxId:671]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01693 (0-290)
  Domains in SCOPe 2.07: d1loka_
• Heterogens: ZN, NA, SCN, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lokA (A:)
  mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
  pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
  giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
  tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
  ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg