PDB entry 1lok

View 1lok on RCSB PDB site
Description: the 1.20 angstrom resolution crystal structure of the aminopeptidase from aeromonas proteolytica complexed with tris: a tale of buffer inhibition
Deposited on 2002-05-06, released 2002-11-27
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.145
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1loka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lokA (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg