PDB entry 1lo0

View 1lo0 on RCSB PDB site
Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex
Deposited on 2002-05-05, released 2002-06-26
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo0H (H:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo0L (L:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo0X (X:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo0Y (Y:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp