PDB entry 1lmt

View 1lmt on RCSB PDB site
Description: structure of a conformationally constrained arg-gly-asp sequence inserted into human lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-01-13, released 1995-03-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00695 (0-129)
    • insertion (73)
    • insertion (73)
    • insertion (73)
    • insertion (73)
    • insertion (73)
  Domains in SCOPe 2.03: d1lmta_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmtA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavcrgdscnachlscsallqdniadavacakrvvrdpqgirawvawrn
  rcqnrdvrqyvqgcgv