PDB entry 1lmt

View 1lmt on RCSB PDB site
Description:
Deposited on 1995-01-13, released 1995-03-31
The last revision prior to the SCOP 1.71 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1lmt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmt_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavcrgdscnachlscsallqdniadavacakrvvrdpqgirawvawrn
    rcqnrdvrqyvqgcgv