PDB entry 1lms

View 1lms on RCSB PDB site
Description: structural model for an alkaline form of ferricytochrome c
Deposited on 2002-05-02, released 2003-03-18
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1lmsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1lmsA (A:)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpakyipgtamafgglkkekdrndlitylkkate

    Sequence, based on observed residues (ATOM records): (download) 
    >1lmsA (A:)
lfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlwdennmseyl
tnpakyipgtamafgglkkekdrndlitylkkate