PDB entry 1lmn

View 1lmn on RCSB PDB site
Description: the refined crystal structure of lysozyme from the rainbow trout (oncorhynchus mykiss)
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-10-19, released 1995-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-07, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rainbow trout lysozyme
  Species: Oncorhynchus mykiss
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11941 (0-128)
    • conflict (85)
  Domains in SCOP 1.73: d1lmna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmnA (A:)
  kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
  rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
  rsyvagcgv