PDB entry 1lmk

View 1lmk on RCSB PDB site
Description:
Deposited on 1994-08-29, released 1995-03-31
The last revision prior to the SCOP 1.65 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lmka1, d1lmka2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lmkc1, d1lmkc2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lmke1, d1lmke2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lmkg1, d1lmkg2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkA (A:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkC (C:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkE (E:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkG (G:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk