PDB entry 1lmj

View 1lmj on RCSB PDB site
Description: NMR Study of the Fibrillin-1 cbEGF12-13 Pair of Ca2+ Binding Epidermal Growth Factor-like Domains
Class: structural protein
Keywords: EGF, calcium, microfibril, neonatal, Marfan syndrome, connective tissue, extracellular matrix
Deposited on 2002-05-02, released 2003-04-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-29, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin 1
    Species: HOMO SAPIENS
    Gene: FBN1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lmja1, d1lmja2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmjA (A:)
    tdidecrispdlcgrgqcvntpgdfeckcdegyesgfmmmkncmdidecqrdpllcrggv
    chntegsyrcecppghqlspnisaci